GH2 (Growth Hormone 2, GH-V, GHL, GHV, HGH-V), IgG1,k, Clone

Trang chủ » K Hgh » GH2 (Growth Hormone 2, GH-V, GHL, GHV, HGH-V), IgG1,k, Clone

Có thể bạn quan tâm

Loading... Product Search All Categories Antibody Proteins/Peptides Kits/Assays Biochemicals Cells/Cell Culture Molecular Biology Chromatography Human Diagnostics Veterinary Diagnostics Lab Supplies Cell Manipulation Search
  • Home
  • Products
  • GH2 (Growth Hormone 2, GH-V, GHL, GHV, hGH-V), Clone: [1D10], Mouse, Monoclonal
GH2 (Growth Hormone 2, GH-V, GHL, GHV, hGH-V), Clone: [1D10], Mouse, Monoclonal Catalog Number: USB-246578
  • Images (0)

    See all images and image information

Product Overview
Article Name: GH2 (Growth Hormone 2, GH-V, GHL, GHV, hGH-V), Clone: [1D10], Mouse, Monoclonal
Biozol Catalog Number: USB-246578
Supplier Catalog Number: 246578
Alternative Catalog Number: USB-246578-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, WB
Immunogen: GH2 (AAH20760.1, 27aa-217aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Product Description
The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation, an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. As in the case of its pituitary counterpart, growth hormone 1, the predominant isoform of this particular family member shows similar somatogenic activity, with reduced lactogenic activity. Mutations in this gene lead to placental growth hormone/lactogen deficiency. [provided by RefSeq Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FPTIPLSRLFDNAMLRARRLYQLAYDTYQEFEEAYILKEQKYSFLQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLRSVFANSLVYGASDSNVYRHLKDLEEGIQTLMWRLEDGSPRTGQIFNQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Product Properties
Clonality: Monoclonal
Clone Designation: [1D10]
NCBI: 20760
Purity: Purified
Form: Supplied as a liquid in PBS, pH 7.4.
Qty 897,00 € Size 100 ug Add to Cart * VAT and and shipping costs not included.Errors and price changes excepted
  • Add to Compare
  • PDF Data Sheet
  • Supplier Data Sheet
Availability
  • 10 bis 15 Tage
ORDER BY EMAIL

[email protected]

Product Guarantee and Expert Support BIOZOL

Từ khóa » K Hgh