H2-3 :: Fluorescent Protein Database

compare

Comparison List

Add h2-3 show comparison clear selection FPbase

• info about FPbase help & FAQs how to cite FPbase contributing API recent activity how you can help contact
• tools spectra viewer microscopes FP BLAST FP collections FRET calculator
• explore

  SEARCH

  advanced search

  BROWSE

  protein table interactive chart lineages organisms spectra references

  SUBMIT

  submit a protein submit a spectrum
• sign in

h2-3 Add to collection Add to favorites 2 h2-3 is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2020, derived from Ricordea sp. FP2-3. It has low acid sensitivity. +

Oligomerization	Organism	Molecular Weight	Cofactor
Dimer	Ricordea sp. FP2-3	26.5 kDa	-

FPbase ID: YQ25V

Attributes

Ex λ	Em λ	EC (M-1 cm-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
506	516	130,000	0.89	115.7	4.6

Edit States/Attributes Edit States/Attributes

Photostability

No photostability measurements available ... add one!

h2-3 Sequence

BLAST MSKLQKGVEKEMKIKLTMNCTVNERNFVITGQGAGEPYDGTQTLYLTVEGGKTLNFSFDVLTPAFQYGNRAFTKYPGNIPDFFKQTFSGGGYTWKRTMTYEDGGVSTVESDISVQGDCFHYKIQFNGKFPPHGPVMQKETVKWEPSTEVMYKDDKNDGVLKGDVNMALLLKDGGHLRVDFNTSYIPKNKVEKMPDYHFVDHRIEILEKPEGRPVKLYAGAVARYSLLPEKNLNK GenBank: BBC08820

Excerpts

No excerpts have been added for h2-3Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Add an excerpt

Primary Reference

Two new coral fluorescent proteins of distinct colors for sharp visualization of cell-cycle progression

Ando R, Sakaue-Sawano A, Shoda K, Miyawaki A

(2020). , , . doi: 10.1101/2020.03.30.015156. Article

Additional References

No additional references have been added.

Add a reference

External Resources

• Search Addgene for h2-3
• Search RIKEN BRC for h2-3

Change history

Something missing or incorrect? Submit a change Submit a change

Add an excerpt

×

You must be logged in to add excerpts to FPbase

sign in Close

Add a reference

×

You must be logged in to add references to FPbase

sign in Close

Add h2-3 to your collection

×

You must be logged in to create protein collections

sign in Close

Spectrum Image URL Builder

×

Dynamically generated spectral images in a variety of formats can be downloaded or embedded elsewhere. This form assists in building the url parameters to retrieve the spectral image that you want.

Image link: Protein h2-3 Image Format SVG PNG JPG PDF Show Name Show X Labels Show Y Labels Show Grid Fill Area Under Curve Transparent Background Min λ nm Max λ nm Opacity Line Width

If you have matplotlib experience, you may also try any of the kwargs parameters for pyplot.plot or pyplot.fill_between (for area plots).