Histone H2A.X Antibody (10856-1-AP) - Proteintech

Có thể bạn quan tâm

  • Products

  • Applications

  • cGMP Proteins

  • Support

  • Services

  • Promotions

  • About Us

English Japanese Chinese
Back
  • Antibodies

  • Immunoassays

  • Cytokines and Growth Factors

  • Nanobody-based Reagents

  • Supporting Tools and Reagents

  • Research Area

  • Genomics

Back

Applications

  • Western Blot
  • Immunohistochemistry
  • Immunofluorescence
  • Immunoprecipitation
  • Flow Cytometry
  • ELISA
  • Cell Separation
  • Cell Regulation
  • Protein Purification
  • Chromatin Immunoprecipitation
  • Live Cell Imaging
  • Antibody LabelingNew
Back

cGMP Proteins

  • cGMP Recombinant Cytokines and Growth Factors
  • Preclinical vs cGMP
  • cGMP Facility in Chicago, IL
  • Custom Order Request
Back

Services

  • Custom Order Request
  • Custom Antibody Services
  • Partnering with Proteintech
Back

Promotions

  • Antibody Upgrade Search Engine
  • New Lab Promotion
  • Publication Promotion
  • Newsletter Sign Up
  • Trial Size Antibodies
  • $149 Control Antibodies
  • Nano-Trap Free Sample
  • Antibody Trial Pack
  • Customer Referral Program
  • 20% off product of the month
  • Buy two, get one free
Back

About Us

  • Contact Us
  • Careers
  • Company Profile
  • The Proteintech Story
  • Humanzyme Acquisition
  • About ChromoTek
  • About Proteintech Genomics
Back

Support

  • Product-specific protocols
  • Standard Protocols
  • Videos
  • Blogs
  • Resources
  • Product Guarantee
  • Learning Portal
  • siRNA Knockdown
  • Technical FAQs
  • Service FAQs
  • Company News
  • Events
  • Featured Products
  • Early Career Researcher Hub
  • CoraLite Plus Fluorescent Dyes
Back

Antibodies

  • Primary Antibodies
  • Secondary Antibodies
  • Recombinant Monoclonal Antibodies
  • Immunofluorescence Antibodies (conjugated)
  • Flow Cytometry Antibodies
  • FcZero-rAb for Flow Cytometry
  • Neutralizing Antibodies
  • Tag Products
  • Loading Control Antibodies
  • Isotype Controls
  • Antibody Labeling Kits
  • Antibody Sampler Kits
Back

Immunoassays

  • ELISA Kits
  • Matched Antibody Pairs
  • IHC Kits
  • Magnetic Cell Separation Systems
  • Cell Health & Proliferation Kits​
  • TSA ReagentsNEW
Back

Cytokines and Growth Factors

  • Research Grade
  • cGMP Grade
Back

Nanobody-based Reagents

  • Nano-Traps
  • Nano-Secondary reagents
  • Chromobodies
  • Nano-Boosters & Nano-Labels
  • Nano-Caps
  • Nano-CaptureLigands
  • Nanobodies/VHHs
  • Spot-Tag System
Back

Supporting Tools & Reagents

  • Protein Ladders
  • Fusion Proteins
  • Blotting Accelerator BufferNew
  • Chemiluminescent Substrate
  • Flow Cytometry Buffers
  • Viability Dyes
Back

Research Area

  • Autophagy and Cell Death
  • COVID-19 Related
  • Cancer
  • Cardiovascular
  • Cell Division and Proliferation
  • Cell and Gene Therapy
  • Developmental Biology
  • Epigenetics
  • Immunology
  • Metabolism
  • Neuroscience
  • Organelle Markers
  • Signal Transduction
  • Stem Cells
Back

Genomics

  • Antibody Cocktails
  • Oligo Conjugated Primary Antibodies
  • Products

    Antibodies

    • Primary Antibodies
    • Secondary Antibodies
    • Recombinant Monoclonal Antibodies
    • Immunofluorescence Antibodies (conjugated)
    • Flow Cytometry Antibodies
    • FcZero-rAb for Flow Cytometry
    • Neutralizing Antibodies
    • Tag Products
    • Loading Control Antibodies
    • Isotype Controls
    • Antibody Labeling Kits
    • Antibody Sampler Kits

    Immunoassays

    • ELISA Kits
    • Matched Antibody Pairs
    • IHC Kits
    • Magnetic Cell Separation Systems
    • Cell Health & Proliferation Kits​
    • TSA ReagentsNEW

    Cytokines and Growth Factors

    • Research Grade
    • cGMP Grade

    Nanobody-based Reagents

    • Nano-Traps
    • Nano-Secondary reagents
    • Chromobodies
    • Nano-Boosters & Nano-Labels
    • Nano-Caps
    • Nano-CaptureLigands
    • Nanobodies/VHHs
    • Spot-Tag System

    Supporting Tools and Reagents

    • Protein Ladders
    • Fusion Proteins
    • Blotting Accelerator BufferNew
    • Chemiluminescent Substrate
    • Flow Cytometry Buffers
    • Viability Dyes

    Research Area

    • Autophagy and Cell Death
    • COVID-19 Related
    • Cancer
    • Cardiovascular
    • Cell Division and Proliferation
    • Cell and Gene Therapy
    • Developmental Biology
    • Epigenetics
    • Immunology
    • Metabolism
    • Neuroscience
    • Organelle Markers
    • Signal Transduction
    • Stem Cells
  • Applications
    • Western Blot
    • Cell Separation
    • Immunohistochemistry
    • Cell Regulation
    • Immunofluorescence
    • Protein Purification
    • Immunoprecipitation
    • Chromatin Immunoprecipitation
    • Flow Cytometry
    • Live Cell Imaging
    • ELISA
    • Antibody Labeling
  • cGMP Proteins
    • cGMP Recombinant Cytokines and Growth Factors
    • Preclinical vs cGMP
    • cGMP Facility in Chicago, IL
    • Custom Order Request
  • Support

    Protocols

    • Product-specific protocols
    • Standard protocols
    • By Application
    • WB
    • IHC
    • IF
    • IP/ChIP
    • Flow Cytometry
    • Cell Culture
    • Antibody Labeling
    • ELISA calculator
    • Spectra viewer
    • Flow cytometry panel builder

    Others

    • Product Guarantee
    • Learning Portal
    • Videos
    • Resources
    • Pathway Posters
    • Technical Workshops
    • Review a Product
    • Technical FAQs
    • Service FAQs
    • Glossary
    • Replace Santa Cruz
    • Featured Products
    • Early Career Researcher Hub
    • CoraLite Plus Fluorescent Dyes

    News

    • Blogs
    • Events
    • Publication Spotlight
    • Scientist Spotlight
    • Company News
  • Services
    • Custom Order Request
    • Custom Antibody Services
    • Partnering with Proteintech
  • Promotions
    • Antibody Upgrade
    • Publication Promotion
    • Newsletter Sign Up
    • New Lab Promotion
    • Trial Size Antibodies
    • $149 Control Antibodies
    • Nano-Trap Free Sample
    • Customer Referral Program
  • About Us
    • Company Profile
    • Careers
    • Contact Us
    • The Proteintech Story
    • Humanzyme Acquisition
    • About ChromoTek
    • About Proteintech Genomics
Country/Region selector No results Country/Region selector No results English Japanese Chinese All
  • All
  • Primary Antibodies
  • Conjugated Antibodies for IF
  • Conjugated Antibodies for FC
  • Secondary Antibodies
  • Antibody Labeling KitsNew
  • ELISA Kits
  • IHC Kits
  • Magnetic Cell Separation Kits
  • Cytokines & Growth Factors
  • Neutralizing/activating Antibodies
  • Nanobody-based Reagents
  • Accessory Products and Kits
  • Fusion Proteins
× × Host 0
  • Alpaca
  • Donkey
  • Goat
  • Mouse
  • Rabbit
Clear Confirm Species Reactivity 0
  • Chicken
  • Goat
  • Guinea Pig
  • Horse
  • Human
  • Mouse
  • Rabbit
  • Rat
  • Sheep
  • Swine
Clear Confirm Species Reactivity 0
  • Human
  • Mouse
  • Rat
  • Pig
  • Bovine
  • Chicken
  • Zebrafish
  • Hamster
  • Monkey
  • Drosophila
Clear Confirm Conjugate 0
  • APC
  • Atlantic Blue™
  • Biotin
  • Cardinal Red™
  • CoraLite® Plus 405
  • CoraLite® Plus 488
  • CoraLite® Plus 647
  • CoraLite® Plus 750
  • CoraLite®488
  • CoraLite®532
  • CoraLite®555
  • CoraLite®568
  • CoraLite®594
  • FITC
  • FITC Plus
  • HRP
  • PE
Clear Confirm Conjugate 0
  • Alexa Fluor® 488
  • Alexa Fluor® 568
  • Alexa Fluor® 647
  • AP
  • Biotin
  • CoraLite®488
  • CoraLite®594
  • CoraLite®647
  • Cy3
  • FITC
  • HRP
  • Rhodamine
  • R-PE
Clear Confirm Compatible Species 0
  • Rabbit
  • Mouse
  • Human
  • Rat
Clear Confirm Conjugate 0
  • CoraLite Plus 405
  • FITC Plus NEW
  • CoraLite Plus 488
  • CoraLite Plus 555
  • CoraLite Plus 647
  • CoraLite Plus 750
Clear Confirm Search Use Able AI chat for product recommendations Chat now Filter: AllWBIHCIF/ICCChIP
  • Western Blot (WB) analysis of various lysates using Histone H2A.X Polyclonal antibody (10856-1-AP)

    WB analysis using 10856-1-AP

    Various lysates were subjected to SDS PAGE followed by western blot with 10856-1-AP (Histone H2A.X antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

    View All Images (8)×

    Various lysates were subjected to SDS PAGE followed by western blot with 10856-1-AP (Histone H2A.X antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

    Western Blot (WB) analysis of various lysates using Histone H2A.X Polyclonal antibody (10856-1-AP)
  • Immunohistochemistry (IHC) staining of human lymphoma tissue using Histone H2A.X Polyclonal antibody (10856-1-AP)

    IHC staining of human lymphoma using 10856-1-AP

    Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 10856-1-AP (Histone H2A.X antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    View All Images (8)×

    Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 10856-1-AP (Histone H2A.X antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    Immunohistochemistry (IHC) staining of human lymphoma tissue using Histone H2A.X Polyclonal antibody (10856-1-AP)
  • Immunohistochemistry (IHC) staining of human lymphoma tissue using Histone H2A.X Polyclonal antibody (10856-1-AP)

    IHC staining of human lymphoma using 10856-1-AP

    Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 10856-1-AP (Histone H2A.X antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    View All Images (8)×

    Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 10856-1-AP (Histone H2A.X antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    Immunohistochemistry (IHC) staining of human lymphoma tissue using Histone H2A.X Polyclonal antibody (10856-1-AP)
  • Immunofluorescence (IF) / fluorescent staining of U2OS cells using Histone H2A.X Polyclonal antibody (10856-1-AP)

    IF Staining of U2OS using 10856-1-AP

    Immunofluorescent analysis of (4% PFA) fixed U2OS cells using Histone H2A.X antibody (10856-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4), CL488-Phalloidin (green).

    View All Images (8)×

    Immunofluorescent analysis of (4% PFA) fixed U2OS cells using Histone H2A.X antibody (10856-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4), CL488-Phalloidin (green).

    Immunofluorescence (IF) / fluorescent staining of U2OS cells using Histone H2A.X Polyclonal antibody (10856-1-AP)
  • Immunofluorescence (IF) / fluorescent staining of MCF-7 cells using Histone H2A.X Polyclonal antibody (10856-1-AP)

    IF Staining of MCF-7 using 10856-1-AP

    Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using Histone H2A.X antibody (10856-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

    View All Images (8)×

    Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using Histone H2A.X antibody (10856-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

    Immunofluorescence (IF) / fluorescent staining of MCF-7 cells using Histone H2A.X Polyclonal antibody (10856-1-AP)
  • Immunofluorescence (IF) / fluorescent staining of MCF-7 cells using Histone H2A.X Polyclonal antibody (10856-1-AP)

    IF Staining of MCF-7 using 10856-1-AP

    Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using Histone H2A.X antibody (10856-1-AP) at dilution of 1:2000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

    View All Images (8)×

    Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using Histone H2A.X antibody (10856-1-AP) at dilution of 1:2000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

    Immunofluorescence (IF) / fluorescent staining of MCF-7 cells using Histone H2A.X Polyclonal antibody (10856-1-AP)
  • Immunofluorescence (IF) / fluorescent staining of U-251 cells using Histone H2A.X Polyclonal antibody (10856-1-AP)

    IF Staining of U-251 using 10856-1-AP

    Immunofluorescent analysis of (4% PFA) fixed U-251 cells using 10856-1-AP (Histone H2A.X antibody), at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

    View All Images (8)×

    Immunofluorescent analysis of (4% PFA) fixed U-251 cells using 10856-1-AP (Histone H2A.X antibody), at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

    Immunofluorescence (IF) / fluorescent staining of U-251 cells using Histone H2A.X Polyclonal antibody (10856-1-AP)
  • ChIP experiment of HEK-293 cells using Histone H2A.X Polyclonal antibody (10856-1-AP)

    ChIP experiment of HEK-293 using 10856-1-AP

    Chromatin was prepared from HEK-293 cells, cells were fixed with formaldehyde for 10 minutes. The ChIP was performed with 18 µg of cross-linked chromatin, 5 µg of Histone H2A Antibody (10856-1-AP) or 5 ug of Normal Rabbit IgG (30000-0-AP), and 30 µl of Protein A Magarose Beads. The immunoprecipitated DNA was quantified by real time PCR. Primers are located in the first kb of the transcribed region.

    View All Images (8)×

    Chromatin was prepared from HEK-293 cells, cells were fixed with formaldehyde for 10 minutes. The ChIP was performed with 18 µg of cross-linked chromatin, 5 µg of Histone H2A Antibody (10856-1-AP) or 5 ug of Normal Rabbit IgG (30000-0-AP), and 30 µl of Protein A Magarose Beads. The immunoprecipitated DNA was quantified by real time PCR. Primers are located in the first kb of the transcribed region.

    ChIP experiment of HEK-293 cells using Histone H2A.X Polyclonal antibody (10856-1-AP)
Histone H2A.X Polyclonal antibody
Histone H2A.X Polyclonal Antibody for WB, IHC, IF/ICC, ChIP, ELISA
Cat No. 10856-1-AP Publications(158) Reviews (3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, CoIP, ChIP, ELISA

Synonyms

H2A, H2AFX, H2A histone family, member X, H2A.X, H2AX

Formulation: PBS, Azide, Glycerol PBS, Azide, Glycerol Conjugate: Unconjugated Unconjugated Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Add to Basket

Please visit your regions distributor:

Proteintech Guarantee

×

Proteintech Guarantee

The Proteintech guarantee covers Proteintech antibodies in any species and any application, including those not listed on the datasheet. If the antibody doesn’t perform, you can receive a hassle-free refund or credit note.

Learn More

Overview

  • Tested Applications
  • Product Information
  • Publications (158)
  • Protocols
  • Reviews (3)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected inHEK-293 cells, HL-60 cells, HEK-293 ells, mouse heart, mouse kidney, rat kidney
Positive IHC detected inhuman lymphoma tissueNote: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells, U-251 cells, U2OS cells
Positive ChIP detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:1000-1:4000
Chromatin immunoprecipitation (ChIP)CHIP : 1:10-1:100
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 116 publications below
IHCSee 16 publications below
IFSee 45 publications below
CoIPSee 1 publications below
ChIPSee 1 publications below

Product Information

10856-1-AP targets Histone H2A.X in WB, IHC, IF/ICC, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1305

Product name: Recombinant human Histone H2A.X protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-143 aa of BC013416

Sequence: MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY

Predict reactive species
Full Name H2A histone family, member X
Calculated Molecular Weight 15 kDa
Observed Molecular Weight 15-18 kDa
GenBank Accession NumberBC013416
Gene Symbol Histone H2A.X
Gene ID (NCBI) 3014
RRIDAB_2114985
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP16104
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Histone H2A.X belongs to the histone H2A family, which is synthesized in G1 and S phase. It is involved in nucleosomal organization of chromatin together with other histone proteins, and is specially important for recombination between immunoglobulin switch regions. H2A.X becomes phosphorylated on serine 139 (to form gamma-H2AFX or H2AX139ph) in response to DNA double strand breaks (DSBs) generated by exogenous genotoxic agents and by stalled replication forks, which promotes DNA repair and maintains genomic stability. The calculated molecular weight of H2AX is 15 kDa, but the ubiquitinated H2A.X is about 22 kDa.

Protocols

Product Specific Protocols
IF protocol for Histone H2A.X antibody 10856-1-APDownload protocol
IHC protocol for Histone H2A.X antibody 10856-1-APDownload protocol
WB protocol for Histone H2A.X antibody 10856-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

  • All (158)
  • WB (116)
  • IHC (16)
  • IF (45)
  • CoIP (1)
  • ChIP (1)
Journal Impact FactorMost recent
  • Human
  • Mouse
  • Rat
  • Monkey
  • Pig
SpeciesApplicationTitle
mouse,humanWB

Nat Aging

Single-cell and spatial RNA sequencing identify divergent microenvironments and progression signatures in early- versus late-onset prostate cancer

View Article

Acta Pharm Sin B

Design, synthesis, and antitumor activity of novel thioheterocyclic nucleoside derivatives by suppressing the c-MYC pathway

View Article
humanWB,IHC,IF

ACS Nano

Polyoxometalate-Based Radiosensitization Platform for Treating Hypoxic Tumors by Attenuating Radioresistance and Enhancing Radiation Response.

View Article
mouseIF

ACS Nano

A Heterojunction Structured WO2.9-WSe2 Nanoradiosensitizer Increases Local Tumor Ablation and Checkpoint Blockade Immunotherapy upon Low Radiation Dose.

View Article
mouseWB

Nat Commun

Telomere dysfunction activates YAP1 to drive tissue inflammation.

View Article
humanWB

Nucleic Acids Res

KDM6B promotes PARthanatos via suppression of O6-methylguanine DNA methyltransferase repair and sustained checkpoint response.

View Article
See more citations

Reviews

    Add a review

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

FH

Kamal (Verified Customer) (02-27-2025)

Mouse liver lysates were subjected to SDS-PAGE and immunoblotted with Histone H2A.X Polyclonal antibody (1:2000 in 1XTBST). Bands appeared at 15 kDa.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: Mouse Liver tissue
Histone H2A.X Antibody Western Blot validation (1:2000 dilution) in Mouse Liver tissue (Cat no:10856-1-AP)
FH

Andreas (Verified Customer) (03-23-2022)

Antibody gives very good signal, hence the dilution factor. One important note is that I include 1:2000 dilution of benzonase in my lysis buffer to recover most of the chromatin-bound material, which big part of it is otherwise lost during the clarification step.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: HEK293FT
FH

kes (Verified Customer) (01-17-2022)

used for WB (1:1000) in milk+TBST buffer and got good results

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: LIver cell lines
×

CHIP Figures

ChIP experiment of HEK-293 cells using Histone H2A.X Polyclonal antibody (10856-1-AP)

ChIP experiment of HEK-293 using 10856-1-AP

Chromatin was prepared from HEK-293 cells, cells were fixed with formaldehyde for 10 minutes. The ChIP was performed with 18 µg of cross-linked chromatin, 5 µg of Histone H2A Antibody (10856-1-AP) or 5 ug of Normal Rabbit IgG (30000-0-AP), and 30 µl of Protein A Magarose Beads. The immunoprecipitated DNA was quantified by real time PCR. Primers are located in the first kb of the transcribed region.

WB Figures

Western Blot (WB) analysis of various lysates using Histone H2A.X Polyclonal antibody (10856-1-AP)

WB analysis using 10856-1-AP

Various lysates were subjected to SDS PAGE followed by western blot with 10856-1-AP (Histone H2A.X antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

IHC Figures

Immunohistochemistry (IHC) staining of human lymphoma tissue using Histone H2A.X Polyclonal antibody (10856-1-AP)

IHC staining of human lymphoma using 10856-1-AP

Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 10856-1-AP (Histone H2A.X antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Immunohistochemistry (IHC) staining of human lymphoma tissue using Histone H2A.X Polyclonal antibody (10856-1-AP)

IHC staining of human lymphoma using 10856-1-AP

Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 10856-1-AP (Histone H2A.X antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

IF/ICC Figures

Immunofluorescence (IF) / fluorescent staining of U2OS cells using Histone H2A.X Polyclonal antibody (10856-1-AP)

IF Staining of U2OS using 10856-1-AP

Immunofluorescent analysis of (4% PFA) fixed U2OS cells using Histone H2A.X antibody (10856-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4), CL488-Phalloidin (green).

Immunofluorescence (IF) / fluorescent staining of MCF-7 cells using Histone H2A.X Polyclonal antibody (10856-1-AP)

IF Staining of MCF-7 using 10856-1-AP

Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using Histone H2A.X antibody (10856-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

Immunofluorescence (IF) / fluorescent staining of MCF-7 cells using Histone H2A.X Polyclonal antibody (10856-1-AP)

IF Staining of MCF-7 using 10856-1-AP

Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using Histone H2A.X antibody (10856-1-AP) at dilution of 1:2000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

Immunofluorescence (IF) / fluorescent staining of U-251 cells using Histone H2A.X Polyclonal antibody (10856-1-AP)

IF Staining of U-251 using 10856-1-AP

Immunofluorescent analysis of (4% PFA) fixed U-251 cells using 10856-1-AP (Histone H2A.X antibody), at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

×

Select download options

English Czech Danish German Spanish Finnish French Hungarian Italian Lithuanian Dutch Norwegian-Bokmol Polish Portuguese Slovak Swedish

Download × The species listed in Tested Reactivity are in-house verified and applicable species. For unlisted species, please refer to the homology analysis of the immunogen sequence and related species. For rabbit polyclonal antibodies, homology >70% is recommended. For mouse monoclonal antibodies and rabbit recombinant antibodies, homology >90% is recommended. Generally, the higher the homology, the greater the applicability. However, there will be certain differences in protein expression in different species, tissues or cells. Therefore, the homology analysis results are for reference only and do not serve as a guarantee. × × Close 3D epitope The epitopes are mapped by Proteintech internal experiments and the 3D view is modeled using NCBI data and Alphafold 2. Reset View all antibodies with epitope mapped Loading... ×

"Histone H2A.X antibodies" comparison

At Proteintech, we pride ourselves on our antibody quality, customer service and transparency. As such, we are comparing our antibodies with other vendors, enabling easy identification and comparisons of key data to help you choose the suitable antibody for your needs.

We have selected the top cited antibodies from these vendors for you to compare.

Proteintech

Histone H2A.X Polyclonal antibody
Catalog Number 10856-1-AP
Citations 159
Dilutions WB : 1:1000-1:4000IHC : 1:50-1:500IF/ICC : 1:1000-1:4000CHIP : 1:10-1:100
Applications WB, IHC, IF/ICC, ChIP, ELISA
Reactivity human, mouse, rat, pig
Product Guarantee
Covers any species including not listed on datasheet
Covers any applications including not listed on datasheet
Hassle-free Refund/ReplacementView Proteintech Guarantee
Host Rabbit
Isotype IgG
Clonality Polyclonal
Clone Number -
Conjugation Unconjugated
View ’s View ’s View ’s
Load More

Last updated: 15th April 2023 Vendors’ pricing may vary slightly

Able AI I'm Able. || New chat Able™ 正在加载,请稍候...

Từ khóa » H2ax Mw