Histone H2A.X Antibody (10856-1-AP) - Proteintech
-
Products
-
Applications
-
cGMP Proteins
-
Support
-
Services
-
Promotions
-
About Us
Back
-
Antibodies
-
Immunoassays
-
Cytokines and Growth Factors
-
Nanobody-based Reagents
-
Supporting Tools and Reagents
-
Research Area
-
Genomics
Back
Applications
- Western Blot
- Immunohistochemistry
- Immunofluorescence
- Immunoprecipitation
- Flow Cytometry
- ELISA
- Cell Separation
- Cell Regulation
- Protein Purification
- Chromatin Immunoprecipitation
- Live Cell Imaging
- Antibody LabelingNew
Back
cGMP Proteins
- cGMP Recombinant Cytokines and Growth Factors
- Preclinical vs cGMP
- cGMP Facility in Chicago, IL
- Custom Order Request
Back
Services
- Custom Order Request
- Custom Antibody Services
- Partnering with Proteintech
Back
Promotions
- Antibody Upgrade Search Engine
- New Lab Promotion
- Publication Promotion
- Newsletter Sign Up
- Trial Size Antibodies
- $149 Control Antibodies
- Nano-Trap Free Sample
- Antibody Trial Pack
- Customer Referral Program
- 20% off product of the month
- Buy two, get one free
Back
About Us
- Contact Us
- Careers
- Company Profile
- The Proteintech Story
- Humanzyme Acquisition
- About ChromoTek
- About Proteintech Genomics
Back
Support
- Product-specific protocols
- Standard Protocols
- Videos
- Blogs
- Resources
- Product Guarantee
- Learning Portal
- siRNA Knockdown
- Technical FAQs
- Service FAQs
- Company News
- Events
- Featured Products
- Early Career Researcher Hub
- CoraLite Plus Fluorescent Dyes
Back
Antibodies
- Primary Antibodies
- Secondary Antibodies
- Recombinant Monoclonal Antibodies
- Immunofluorescence Antibodies (conjugated)
- Flow Cytometry Antibodies
- FcZero-rAb for Flow Cytometry
- Neutralizing Antibodies
- Tag Products
- Loading Control Antibodies
- Isotype Controls
- Antibody Labeling Kits
- Antibody Sampler Kits
Back
Immunoassays
- ELISA Kits
- Matched Antibody Pairs
- IHC Kits
- Magnetic Cell Separation Systems
- Cell Health & Proliferation Kits
- TSA ReagentsNEW
Back
Cytokines and Growth Factors
- Research Grade
- cGMP Grade
Back
Nanobody-based Reagents
- Nano-Traps
- Nano-Secondary reagents
- Chromobodies
- Nano-Boosters & Nano-Labels
- Nano-Caps
- Nano-CaptureLigands
- Nanobodies/VHHs
- Spot-Tag System
Back
Supporting Tools & Reagents
- Protein Ladders
- Fusion Proteins
- Blotting Accelerator BufferNew
- Chemiluminescent Substrate
- Flow Cytometry Buffers
- Viability Dyes
Back
Research Area
- Autophagy and Cell Death
- COVID-19 Related
- Cancer
- Cardiovascular
- Cell Division and Proliferation
- Cell and Gene Therapy
- Developmental Biology
- Epigenetics
- Immunology
- Metabolism
- Neuroscience
- Organelle Markers
- Signal Transduction
- Stem Cells
Back
Genomics
- Antibody Cocktails
- Oligo Conjugated Primary Antibodies
- Products
Antibodies
- Primary Antibodies
- Secondary Antibodies
- Recombinant Monoclonal Antibodies
- Immunofluorescence Antibodies (conjugated)
- Flow Cytometry Antibodies
- FcZero-rAb for Flow Cytometry
- Neutralizing Antibodies
- Tag Products
- Loading Control Antibodies
- Isotype Controls
- Antibody Labeling Kits
- Antibody Sampler Kits
Immunoassays
- ELISA Kits
- Matched Antibody Pairs
- IHC Kits
- Magnetic Cell Separation Systems
- Cell Health & Proliferation Kits
- TSA ReagentsNEW
Cytokines and Growth Factors
- Research Grade
- cGMP Grade
Nanobody-based Reagents
- Nano-Traps
- Nano-Secondary reagents
- Chromobodies
- Nano-Boosters & Nano-Labels
- Nano-Caps
- Nano-CaptureLigands
- Nanobodies/VHHs
- Spot-Tag System
Supporting Tools and Reagents
- Protein Ladders
- Fusion Proteins
- Blotting Accelerator BufferNew
- Chemiluminescent Substrate
- Flow Cytometry Buffers
- Viability Dyes
Research Area
- Autophagy and Cell Death
- COVID-19 Related
- Cancer
- Cardiovascular
- Cell Division and Proliferation
- Cell and Gene Therapy
- Developmental Biology
- Epigenetics
- Immunology
- Metabolism
- Neuroscience
- Organelle Markers
- Signal Transduction
- Stem Cells
- Applications
- Western Blot
- Cell Separation
- Immunohistochemistry
- Cell Regulation
- Immunofluorescence
- Protein Purification
- Immunoprecipitation
- Chromatin Immunoprecipitation
- Flow Cytometry
- Live Cell Imaging
- ELISA
- Antibody Labeling
- cGMP Proteins
- cGMP Recombinant Cytokines and Growth Factors
- Preclinical vs cGMP
- cGMP Facility in Chicago, IL
- Custom Order Request
- Support
Protocols
- Product-specific protocols
- Standard protocols
- By Application
- WB
- IHC
- IF
- IP/ChIP
- Flow Cytometry
- Cell Culture
- Antibody Labeling
- ELISA calculator
- Spectra viewer
- Flow cytometry panel builder
Others
- Product Guarantee
- Learning Portal
- Videos
- Resources
- Pathway Posters
- Technical Workshops
- Review a Product
- Technical FAQs
- Service FAQs
- Glossary
- Replace Santa Cruz
- Featured Products
- Early Career Researcher Hub
- CoraLite Plus Fluorescent Dyes
News
- Blogs
- Events
- Publication Spotlight
- Scientist Spotlight
- Company News
- Services
- Custom Order Request
- Custom Antibody Services
- Partnering with Proteintech
- Promotions
- Antibody Upgrade
- Publication Promotion
- Newsletter Sign Up
- New Lab Promotion
- Trial Size Antibodies
- $149 Control Antibodies
- Nano-Trap Free Sample
- Customer Referral Program
- About Us
- Company Profile
- Careers
- Contact Us
- The Proteintech Story
- Humanzyme Acquisition
- About ChromoTek
- About Proteintech Genomics
- All
- Primary Antibodies
- Conjugated Antibodies for IF
- Conjugated Antibodies for FC
- Secondary Antibodies
- Antibody Labeling KitsNew
- ELISA Kits
- IHC Kits
- Magnetic Cell Separation Kits
- Cytokines & Growth Factors
- Neutralizing/activating Antibodies
- Nanobody-based Reagents
- Accessory Products and Kits
- Fusion Proteins
- Alpaca
- Donkey
- Goat
- Mouse
- Rabbit
- Chicken
- Goat
- Guinea Pig
- Horse
- Human
- Mouse
- Rabbit
- Rat
- Sheep
- Swine
- Human
- Mouse
- Rat
- Pig
- Bovine
- Chicken
- Zebrafish
- Hamster
- Monkey
- Drosophila
- APC
- Atlantic Blue™
- Biotin
- Cardinal Red™
- CoraLite® Plus 405
- CoraLite® Plus 488
- CoraLite® Plus 647
- CoraLite® Plus 750
- CoraLite®488
- CoraLite®532
- CoraLite®555
- CoraLite®568
- CoraLite®594
- FITC
- FITC Plus
- HRP
- PE
- Alexa Fluor® 488
- Alexa Fluor® 568
- Alexa Fluor® 647
- AP
- Biotin
- CoraLite®488
- CoraLite®594
- CoraLite®647
- Cy3
- FITC
- HRP
- Rhodamine
- R-PE
- Rabbit
- Mouse
- Human
- Rat
- CoraLite Plus 405
- FITC Plus NEW
- CoraLite Plus 488
- CoraLite Plus 555
- CoraLite Plus 647
- CoraLite Plus 750
Use Able AI chat for product recommendations Chat now Filter: AllWBIHCIF/ICCChIP
WB analysis using 10856-1-AP
View All Images (8)×Various lysates were subjected to SDS PAGE followed by western blot with 10856-1-AP (Histone H2A.X antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

Histone H2A.X Polyclonal Antibody for WB, IHC, IF/ICC, ChIP, ELISA
Cat No. 10856-1-AP Publications(158) Reviews (3)Host / Isotype
Rabbit / IgG
Reactivity
human, mouse, rat and More (1)
Applications
WB, IHC, IF/ICC, CoIP, ChIP, ELISA
Synonyms
Formulation: PBS, Azide, Glycerol PBS, Azide, Glycerol Conjugate: Unconjugated Unconjugated Size/Concentration:-/ -
Freight/Packing: -
Quantity- +
Request bulk or custom quote
Add to BasketPlease visit your regions distributor:
Proteintech Guarantee
×Proteintech Guarantee
The Proteintech guarantee covers Proteintech antibodies in any species and any application, including those not listed on the datasheet. If the antibody doesn’t perform, you can receive a hassle-free refund or credit note.
Learn More
Overview
- Tested Applications
- Product Information
- Publications (158)
- Protocols
- Reviews (3)
Print datasheet
MSDS SDS
Tested Applications
| Positive WB detected in | HEK-293 cells, HL-60 cells, HEK-293 ells, mouse heart, mouse kidney, rat kidney |
| Positive IHC detected in | human lymphoma tissueNote: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells, U-251 cells, U2OS cells |
| Positive ChIP detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:4000 |
| Chromatin immunoprecipitation (ChIP) | CHIP : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 116 publications below |
| IHC | See 16 publications below |
| IF | See 45 publications below |
| CoIP | See 1 publications below |
| ChIP | See 1 publications below |
Product Information
10856-1-AP targets Histone H2A.X in WB, IHC, IF/ICC, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag1305 Product name: Recombinant human Histone H2A.X protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-143 aa of BC013416 Sequence: MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY Predict reactive species |
| Full Name | H2A histone family, member X |
| Calculated Molecular Weight | 15 kDa |
| Observed Molecular Weight | 15-18 kDa |
| GenBank Accession Number | BC013416 |
| Gene Symbol | Histone H2A.X |
| Gene ID (NCBI) | 3014 |
| RRID | AB_2114985 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P16104 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Histone H2A.X belongs to the histone H2A family, which is synthesized in G1 and S phase. It is involved in nucleosomal organization of chromatin together with other histone proteins, and is specially important for recombination between immunoglobulin switch regions. H2A.X becomes phosphorylated on serine 139 (to form gamma-H2AFX or H2AX139ph) in response to DNA double strand breaks (DSBs) generated by exogenous genotoxic agents and by stalled replication forks, which promotes DNA repair and maintains genomic stability. The calculated molecular weight of H2AX is 15 kDa, but the ubiquitinated H2A.X is about 22 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Histone H2A.X antibody 10856-1-AP | Download protocol |
| IHC protocol for Histone H2A.X antibody 10856-1-AP | Download protocol |
| WB protocol for Histone H2A.X antibody 10856-1-AP | Download protocol |
| Standard Protocols |
|---|
| Click here to view our Standard Protocols |
Publications
- All (158)
- WB (116)
- IHC (16)
- IF (45)
- CoIP (1)
- ChIP (1)
- Human
- Mouse
- Rat
- Monkey
- Pig
| Species | Application | Title |
|---|---|---|
| mouse,human | WB | Nat Aging Single-cell and spatial RNA sequencing identify divergent microenvironments and progression signatures in early- versus late-onset prostate cancerView Article |
Acta Pharm Sin B Design, synthesis, and antitumor activity of novel thioheterocyclic nucleoside derivatives by suppressing the c-MYC pathwayView Article | ||
| human | WB,IHC,IF | ACS Nano Polyoxometalate-Based Radiosensitization Platform for Treating Hypoxic Tumors by Attenuating Radioresistance and Enhancing Radiation Response.View Article |
| mouse | IF | ACS Nano A Heterojunction Structured WO2.9-WSe2 Nanoradiosensitizer Increases Local Tumor Ablation and Checkpoint Blockade Immunotherapy upon Low Radiation Dose.View Article |
| mouse | WB | Nat Commun Telomere dysfunction activates YAP1 to drive tissue inflammation.View Article |
| human | WB | Nucleic Acids Res KDM6B promotes PARthanatos via suppression of O6-methylguanine DNA methyltransferase repair and sustained checkpoint response.View Article |
Reviews
- Add a review
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
| FH Kamal (Verified Customer) (02-27-2025) | Mouse liver lysates were subjected to SDS-PAGE and immunoblotted with Histone H2A.X Polyclonal antibody (1:2000 in 1XTBST). Bands appeared at 15 kDa.
![]() |
| FH Andreas (Verified Customer) (03-23-2022) | Antibody gives very good signal, hence the dilution factor. One important note is that I include 1:2000 dilution of benzonase in my lysis buffer to recover most of the chromatin-bound material, which big part of it is otherwise lost during the clarification step.
|
| FH kes (Verified Customer) (01-17-2022) | used for WB (1:1000) in milk+TBST buffer and got good results
|
CHIP Figures

ChIP experiment of HEK-293 using 10856-1-AP
Chromatin was prepared from HEK-293 cells, cells were fixed with formaldehyde for 10 minutes. The ChIP was performed with 18 µg of cross-linked chromatin, 5 µg of Histone H2A Antibody (10856-1-AP) or 5 ug of Normal Rabbit IgG (30000-0-AP), and 30 µl of Protein A Magarose Beads. The immunoprecipitated DNA was quantified by real time PCR. Primers are located in the first kb of the transcribed region.
WB Figures

WB analysis using 10856-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 10856-1-AP (Histone H2A.X antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
IHC Figures

IHC staining of human lymphoma using 10856-1-AP
Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 10856-1-AP (Histone H2A.X antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

IHC staining of human lymphoma using 10856-1-AP
Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 10856-1-AP (Histone H2A.X antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IF/ICC Figures

IF Staining of U2OS using 10856-1-AP
Immunofluorescent analysis of (4% PFA) fixed U2OS cells using Histone H2A.X antibody (10856-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4), CL488-Phalloidin (green).

IF Staining of MCF-7 using 10856-1-AP
Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using Histone H2A.X antibody (10856-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

IF Staining of MCF-7 using 10856-1-AP
Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using Histone H2A.X antibody (10856-1-AP) at dilution of 1:2000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

IF Staining of U-251 using 10856-1-AP
Immunofluorescent analysis of (4% PFA) fixed U-251 cells using 10856-1-AP (Histone H2A.X antibody), at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
×Select download options
English Czech Danish German Spanish Finnish French Hungarian Italian Lithuanian Dutch Norwegian-Bokmol Polish Portuguese Slovak Swedish
Download × The species listed in Tested Reactivity are in-house verified and applicable species. For unlisted species, please refer to the homology analysis of the immunogen sequence and related species. For rabbit polyclonal antibodies, homology >70% is recommended. For mouse monoclonal antibodies and rabbit recombinant antibodies, homology >90% is recommended. Generally, the higher the homology, the greater the applicability. However, there will be certain differences in protein expression in different species, tissues or cells. Therefore, the homology analysis results are for reference only and do not serve as a guarantee. × × Close 3D epitope The epitopes are mapped by Proteintech internal experiments and the 3D view is modeled using NCBI data and Alphafold 2. Reset View all antibodies with epitope mapped Loading... ×"Histone H2A.X antibodies" comparison
At Proteintech, we pride ourselves on our antibody quality, customer service and transparency. As such, we are comparing our antibodies with other vendors, enabling easy identification and comparisons of key data to help you choose the suitable antibody for your needs.
We have selected the top cited antibodies from these vendors for you to compare.
Proteintech | ||||
| Histone H2A.X Polyclonal antibody | ||||
| Catalog Number | 10856-1-AP | |||
| Citations | 159 | |||
| Dilutions | WB : 1:1000-1:4000IHC : 1:50-1:500IF/ICC : 1:1000-1:4000CHIP : 1:10-1:100 | |||
| Applications | WB, IHC, IF/ICC, ChIP, ELISA | |||
| Reactivity | human, mouse, rat, pig | |||
| Product Guarantee | ||||
| Covers any species including not listed on datasheet | ||||
| Covers any applications including not listed on datasheet | ||||
| Hassle-free Refund/ReplacementView Proteintech Guarantee | ||||
| Host | Rabbit | |||
| Isotype | IgG | |||
| Clonality | Polyclonal | |||
| Clone Number | - | |||
| Conjugation | Unconjugated | |||
| View ’s | View ’s | View ’s |
Last updated: 15th April 2023 Vendors’ pricing may vary slightly
Able AI I'm Able. || New chat Able™ 正在加载,请稍候... Từ khóa » H2ax Mw
-
Gamma H2AX [p Ser139] Antibody (NB100-384) - Novus Biologicals
-
Gamma H2AX [p Ser139] Antibody (NB100-81963) - Novus Biologicals
-
Phospho-Histone H2A.X (Ser139) Antibody#2577
-
Histone H2A.X Antibody#2595 - Cell Signaling Technology
-
P16104 (h2ax_human) - UniProt
-
Anti-gamma H2A.X (phospho S139) Antibody (ab11174) - Abcam
-
Phospho-Histone H2A.X (Ser139) Antibody (MA1-2022)
-
Human/Mouse/Rat Histone H2AX Antibody MAB3406 - R&D Systems
-
Monoubiquitinated γ-H2AX: Abundant Product And Specific ... - NCBI
-
[pSer139]Histone H2AX Monoclonal Antibody (9F3) - ADI-KAM-CC255
-
Ionizing Radiation–dependent γ-H2AX Focus Formation Requires ...
-
RNF168 Ubiquitinates K13-15 On H2A/H2AX To Drive DNA Damage ...
-
H2AX PS139 Antibody, Anti-human/mouse, REAfinity - Miltenyi Biotec







